Conserved Protein Domain Family
PHA02417

?
PHA02417: PHA02417 
hypothetical protein
Statistics
?
PSSM-Id: 164914
View PSSM: PHA02417
Aligned: 3 rows
Threshold Bit Score: 126.32
Threshold Setting Gi: 117676332
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
117676332  1 MARPLYRIRQFAQSRVRGGKLFCAGACQVQQRVAGLFWLEIAYCSDRTGAEAAIRAAVIARRRARLKPRVLGLFDRDGQA 80 
134288766  1 MARPLYRIRQFAQSRMRGGKLFCAGACQVQQRVAGLFWLEIAYCSDRTGAEAAIRAAVIARRRARLKPRVLGLFDRDGQA 80 
134288698  1 MARPLYRIRQFAQSRVRGGKLFCVGACQVQQRVAGLFWLEIAYCSDRTGAEAAIRAAVIARRRARLKPRVLGLFDRDGQA 80 
117676332 81 LGQ 83 
134288766 81 LGQ 83 
134288698 81 LGQ 83 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap