Conserved Protein Domain Family
PHA02415

?
PHA02415: PHA02415 
DNA primase domain-containing protein
Statistics
?
PSSM-Id: 177362
View PSSM: PHA02415
Aligned: 3 rows
Threshold Bit Score: 2002.21
Threshold Setting Gi: 72537680
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
134288779   1 MATIDELKQRIDLHDLADRLGLKRGR-------GGDKALYHSPQHEDKSPSLSIYVNHPKHGTGWRDHSADAGGSCIDLV 73  
72537680    1 MATIDELKQRIDLHDLADRLGLKRGR-------GGDKALYHSPQHEDKSPSLSIYVNHPKHGTGWRDHSADAGGSCIDLV 73  
145708121   1 MASIEELKKRIDLHDLAERLGIKRGPgaikrgaGGDQALYHSPLHADKNPSLSIFVNHPTHGTGWKEHSTGDGGSCIDLV 80  
134288779  74 IHARGGTVADAVRYLHDAYGIPLDRPA-PAERREKSTVEYIADRCLAERERVREYLGGRGISAAAIDAAFAARSLGFNTW 152 
72537680   74 IHARGGTVADAVRYLHDAYGIPLDRPA-PAERREKSTVEYIADRCLAERDRVREYLGGRGISAAAIDAAFAARSLGFNTW 152 
145708121  81 ILARGGDASDAVKWLHEAYAIPFDKPAgQPERREKSKAEYIADRCHAEREQVRPYLAGRGISDAAIDAAFRARTLGYNAW 160 
134288779 153 TSSKVAASEVGHAGPAAAFIVREPADGRVVAVDMRYVDPALNGGVKTQTQGDKAGYGWTADARRLDKAKRIFIVESAINA 232 
72537680  153 TSSKVAAGEVGHAGPAAAFIVREPADGRVVAVDMRYVDPALNGGVKTQTQGDKAGYGWTADARRLDKAKRVFIVESAINA 232 
145708121 161 TSPKLAAGSVGHGGPAAAFIVQSLNPGHVVGVDMRYFDPALNGNVKTQSQGEKAGYGWTADPARLARAKRVYLVESPINA 240 
134288779 233 LSIDTCAMPGAAALALRGLANVDAIDFSSLRGKQVVICLDNDEPFTDGHPRAGHRPGPEAAWALYERLASLNISAVLVDQ 312 
72537680  233 LSIDTCAMPGAAALALRGLANVDAIDFSSLRGKQVVICLDNDEPFADGHPRAGHRPGPEAAWALYERLASLNISAVLVDQ 312 
145708121 241 LSIDTCRIPGAAAFALRGLSNVDDIDFSFLQGKQCIICMDNDEPFEHDHPRAGQRPGPEAAWTLYERLTALNISAVLVDQ 320 
134288779 313 AGWLADLADGETKQQPINDVNDYLQLRGPVELARALEQLEPWLIAGLAGDATRRGRPRIFLPSHDFAQYWRFRVRPDFTS 392 
72537680  313 AGWLADLADGETKQQPINDVNDYLQLRGPAELARALEQLEPWLIAGLAGDASRRGRPRIFLPSHDFAQYWRFRTRPDFTS 392 
145708121 321 SEWVNGLNDDKTAAESINDVNDYLQARGAEQLARALDKFDPWVIAGMVGDTTRRGRPRVHLPAHDYAQYWRFRVKQDFTS 400 
134288779 393 YITKMDRNEE--SGVETPVMTDLCGFRIAGISRVSVASATSTMTGDADQAPTVYFAVSVQTPRHGAQLVRRVMLDDQLHN 470 
72537680  393 YITKMDRNEE--SGVETPVMTDLCGFRIAGISRVSVASATSTMTGDADQAPTVYFAVSVQTPRHGAQLIRRVMLDDQLHN 470 
145708121 401 YITKMDRRSEgdDDVETPVYTDLCGFRIASISRVSVAGATATMTGDPDQSPTVYFAVSVQAPRHGAKLIRRVMLDDQLHN 480 
134288779 471 VDQWGKFGPIWAPAPFKRMVNILERGADLGARQAANFVGLAWRDGRLIVNEGPDCYFTEADKQCPYHNLTFPSGSTSDAR 550 
72537680  471 VDQWGKFGPIWTPAPFKRMVNILERGADLGARQAANFVGLAWRDGRLIVNEGPDCYFTEADKQCPYHNLTFPSGPTSDAR 550 
145708121 481 TDLWGKFGPIWAPAPFKRMVNILERTADLGARDAANFVGVAWRDGRLIVNEGPDCYFTEPERQCPYHNLTFPSGPTRDAA 560 
134288779 551 RVITAYQTTFRQNAATIPLVWALGGHLKALLGFWPHITIQANKGAGKSTLIKRLERSLAFTMFSGQSLQTEFRLLTSISH 630 
72537680  551 RVIAAYQTTFKQNAATIPLVWALGGHLKALLGFWPHITIQANKGAGKSTLIKRLERSLAFTMFSGQSLQTEFRLLTSISH 630 
145708121 561 KVLAAFQETFKQNAATIPLVWALGGHLKALLGFWPHMTVQADKGAGKSTLIKRLERALAFTMLSGQSLQTEFRLLTSVSH 640 
134288779 631 TSHPVGWEELSARRQDVIDKAVGLLQENYQYTVTRRGTDMTEYLLCAPVMLAGEDVPVRSLLGKLVRTTLTGKRGPLLPD 710 
72537680  631 TSHPVGWEELSARRQDVIDKAVGLLQENYQYTVTRRGTDMTEYLLCAPVMLAGEDVPVRSLLGKLVRTTLTGKRGPLLPD 710 
145708121 641 TSHPVGWEELSARRQEIIDKAVGLLQENYQYTVTKRGADMTEYLICAPVMLAGEDVPVRSLLGKLVRTNLTGKKGPMMPD 720 
134288779 711 DLPRFPVRQWLEYLAGLDKRAVLEHYATLRDKALAKCIASGADDGANRMAANYAAVALAWRYLCEFAGMDPSEGGFPHDL 790 
72537680  711 DLPRFPVRQWLEYLAGLDKRAVLEHYATLRDKALAKCIASGADDGANRMAANYAAVALAWRYLCEFAGMDPSEGGFPHDL 790 
145708121 721 DLPRFPVKQWLQFLASLDKATVLAEYRKIHAYCVRMARATGEDAGAERMISNYAAVMLAWRYLAEFASVDHSTGNFINDL 800 
134288779 791 LAEMNGHVAETSADREPWVWIMETVLSEIDGGNYKHPYTFDTVDGEFCLLLRTGHVMDHLAHTSALRDKWNGLPVKSDRV 870 
72537680  791 LAEMNSHVAETSADREPWVWIMETVLSEIDGGNYKHPYTFDTVDGEFCLLLRTGHVMDHLAHTSALRDKWNGLPVKSDRV 870 
145708121 801 LAEMNAHIAETSADREPWVWIMETALSEIDAGKYTYPTAFDVVDGEHCILLRTSHIMDHIAHSSALREKWNGLPVKSDRV 880 
134288779 871 FKTQLKHAGVVVGEKEVERRIYTRRVPYLTPVSLERLAAFGLHVSVREDLATDALERSHA 930 
72537680  871 FKTQLKHAGVVVGEKEVERRIYTRRVPYLTPVSLERLAAFGLHVSVREDLATDALERSHA 930 
145708121 881 FKKQLYNAGVVAGDKEIERTIFSRRVGHLTPISLQRLAGYGLSVAIRED------AHAHA 934 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap