Conserved Protein Domain Family
PHA02414

?
PHA02414: PHA02414 
hypothetical protein
Statistics
?
PSSM-Id: 107179
View PSSM: PHA02414
Aligned: 3 rows
Threshold Bit Score: 142.708
Threshold Setting Gi: 66395125
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
158079516   1 MNDYQVNDLVLRLQRLEDKLQHGELTEKGikqDNVELNSAVSELRDIVNSLDKRLAVHEEKYAHLTYQITKLEETIDALE 80 
157325212   2 EKDTNIQSLLDKIKNLEDKVQTGELTRKT---DNEELTKAIKELRDIVVALDKDSALQSEKQSHIFYQIGQLEKGVEALR 78 
66395125    1 -MDKEINNLVSQVETIKSKIQEGNYIDRG---TFKDLEVEVAELRKMIVSIDKDVAVNSEKQSAIYVQLERLDEKISELA 76 
158079516  81 GVNDKEFDHKRDIVENVFMIVLGAVVTYVFSMFK 114
157325212  79 QTNQKEDEGKKDLVEKVFMIILGAVVTYVFSLVK 112
66395125   77 ESTKTKDTEKKDTTEKVLLLVLGAILSFVFNKFA 110
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap