Conserved Protein Domain Family
PHA02337

?
PHA02337: PHA02337 
putative high light inducible protein
Statistics
?
PSSM-Id: 177361
View PSSM: PHA02337
Aligned: 4 rows
Threshold Bit Score: 56.1318
Threshold Setting Gi: 255928946
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
61806380   1 MTPEAERFNGWSAMIGFVAAVGAYATTGQIIPGIF 35 
58532984   5 FTPEAEILNARLAMLGFVIAVGTYATTGQIIPGVW 39 
61806145   1 MTPEAEKFNGWMAMIGFVAAFGAYATTGQIIPGIF 35 
255928946  5 FTPEAEILNARLAMLGFVIAVGTYFTTGQIIPGVW 39 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap