Conserved Protein Domain Family
PHA02335

?
PHA02335: PHA02335 
hypothetical protein
Statistics
?
PSSM-Id: 164910
View PSSM: PHA02335
Aligned: 4 rows
Threshold Bit Score: 190.018
Threshold Setting Gi: 61806074
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
61806074    1 MKFDELNESNYMLFAIKFYDNPQAVTKDDFESDLKRIRYIKRLLKRYKNTGELKIHLILNHITILFNVFNEAAVPLLFYN 80 
113200696   1 MKFDELNEGNYILFAIKHYENPQCVTRDDFDEDMKRFKYLKRLFKRYLNGSDIRTHLILNHLIILYNVFGEATTPLLFYK 80 
58532958    1 MQFNELTPENWMFFAIQNYNNPQSVTYDDFEEDLNRIRYIKRLFKRYDSTGELKTHLILNHIIVMYNVFGDAATPLLFYK 80 
255928979   1 MNFNELTPDNWLFFAIQNYNNPSSVTYSDFEEDLKRFKYIKRLLKRYETTGELKTHLILNHVIVLYNVFDDAATPLLFYK 80 
61806074   81 LEEELWPCIKSFLVFLNRIPE--YPrtkinDIEVDDDCLKQLNTV 123
113200696  81 LEREYWPAIKSFLMFLNKYPIgcFP-----TLEADQQILEELEQL 120
58532958   81 TEAIHWSYLKAFMLFLNRLPD--SL-----NEDVDQECLRQLNLI 118
255928979  81 TEATYWSQIKAFMLFLNRLPP--LL-----NEDVDEECLKSLNLI 118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap