Conserved Protein Domain Family
PHA02334

?
PHA02334: PHA02334 
hypothetical protein
Statistics
?
PSSM-Id: 164909
View PSSM: PHA02334
Aligned: 4 rows
Threshold Bit Score: 89.1236
Threshold Setting Gi: 255928981
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
113200694  1 MLAFLLPLASKVISDAVNKIPENEELGEKLVEICLVILGKAVKLTKTDMDDQLLEVVKKAMVAR 64 
61806363   1 MLSFLLPFASKIVSDAVNKIPDDSELGESLIKLCIVILEKAVKLTKTDMDDKLLETVKSAIETR 64 
58532956   1 MLSFLLPFAYKIVDSAVDRIPDDAELGDKLIEICLLIIGKAVRLTHTTADDELFIKVAEAIRSR 64 
255928981  1 MLSFLLPLAAKIVKDAVAKVPDNEELGEKLVEICILVLEKAVKLTKTEMDDNLLEVVKKAIAAR 64 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap