Conserved Protein Domain Family
PHA02310

?
PHA02310: PHA02310 
hypothetical protein
Statistics
?
PSSM-Id: 177359
View PSSM: PHA02310
Aligned: 8 rows
Threshold Bit Score: 220.905
Threshold Setting Gi: 48697509
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
48697509    1 MSVPGLNLLAMALGLIASETVEYFAETGRTKQPNGVFIASYASPVPIeECSVQAVDRSKYTDLGLDFQKTYVTWFVpNQA 80 
149408340   1 MVIPGANLLRMAFSVIGTQLVQYRKFEQRTKNSQAQYVSVFGEPFQL-AASIQRVRRDQYVQFNLEFQRNYVMIFA-NFE 78 
126011048   1 MIVPGSNLFMQAASVIALTPVPYLRFTQRVLNPARQWITTYAAAVDV-PMSVQRVPRNKYVQFGLEFQRNYVRLFA-PIE 78 
197261445   1 -MIPGANLLRMAFGVIGTQIVRYRKFEQRVKSDQAQYVSMFGEPFDL-AASVQRVRRDQYAQFNLEFQRNYVMIFA-NFD 77 
218457829   1 -MIPGANLLRMAFGVIGTQIVRYRKFEQRVKNDQAQYVSMFGEPFDL-AASVQRVRRDQYAQFNLEFQRNYVMIFA-NFD 77 
218148567   1 MVIPGANLLRMAFGVIGTQIVRYRKFEQRVKNDQAQYVSMFGEPFDL-AASVQRVRRDQYAQFNLEFQRNYVMIFA-NFD 78 
219523896   1 MVIPGANLLRMAFSVIGTQFVQYRKFEQRTKNSQAQYVSVFGEPFQL-AASIQRVRRDQYVQFNLEFQRNYVMIFA-NFE 78 
197261353   1 -MIPGANLLRMAFGVIGTQIVRYRKFEQRVKNDQAQYVSMFGEPFDL-AASVQRVRRDQYAQFNLEFQRNYVMIFA-NFD 77 
48697509   81 FTTIKRGKAGDVLEWNGGRYQMNGGIDWTGQDSWGTATCVLIGPATGALTNG 132
149408340  79 MVDLDRDLAGDQFIWTGRVFQLESQGSWFYQDGWGVCLAVDIGTAKLAEDGT 130
126011048  79 MVDLDRDCGGDMIIWHGRQHKIESQNTWYLQDGWAMSLAVDLG-IRSDQKGN 129
197261445  78 MVDLDRNMAGDQFLWTGRVFQLESQGSWFYQDGWGVCLAVDIGAAKFTDDGK 129
218457829  78 MVDLDRNMAGDQFLWTGRVFQLESQGSWFYQDGWGVCLAVDIGAAKFTDDGK 129
218148567  79 MVDLDRNMAGDQFLWTGRVFQLESQGSWFYQDGWGVCLAVDIGAAKLTDDGK 130
219523896  79 MVDLDRDLAGDQFIWTGRVFQLESQGSWFYQDGWGVCLAVDIGTAKLAEDGT 130
197261353  78 MVDLDRNMAGDQFLWTGRVFQLESQGSWFYQDGWGVCLAVDIGAAKLTDDGK 129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap