Conserved Protein Domain Family
PHA02291

?
PHA02291: PHA02291 
hypothetical protein
Statistics
?
PSSM-Id: 177358
View PSSM: PHA02291
Aligned: 3 rows
Threshold Bit Score: 93.6478
Threshold Setting Gi: 48696493
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
48696493   1 MSRKASIFYILVVIVLAFSISSYYISSFMYHDKAKNEVSTELSNTGKIKEEKNVEFVGDYTLKKVEDNKAYFMETLPTYL 80 
66391349   1 MSSKKWLFYVLLFAVLLSAVFAYSWTSIYYEKNAYDSGVVQDSESNNTKNNGDIEYVTTVTLKKDTDKKATFMDELPNFL 80 
66395054   1 MSRKASIFYILVVIVLAFSISSYYISSFMYHDKAKNEVSTELSNTGKIKEEKNVEFVGDYTLKKVEDNKAYFMETLPTYL 80 
48696493  81 PGRTGDNSIDMRYYKTSRFKEGVNFKLIRVYTEDGEDNPIHKYRFEAVPTK 131
66391349  81 PGRTDGKTIDKSFYKSSDFREGERFKLYRIYTRDNNGEVTHKYRFEKEVDN 131
66395054  81 PGRTGDNSIDMRYYKTSRFKEGVNFKLIRVYTEDGEDNPIHKYRFEAVPTK 131
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap