Conserved Protein Domain Family
PHA02284

?
PHA02284: PHA02284 
hypothetical protein
Statistics
?
PSSM-Id: 107167
View PSSM: PHA02284
Aligned: 3 rows
Threshold Bit Score: 175.735
Threshold Setting Gi: 66394995
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66394995   1 MGIIVNSNHIQSDTLYEYDSFFDIEKVDTFEEGLLSI------QDEPTVLAGFIYdditfnkvinsNSDIDDYIK-NNDI 73 
66391301   1 MLIIYNKNHIQSKEVHKHLGYSVNENVCAVVNNQDAIkvvkesQDTDIMLVGFIY-----------TKDLECLVElGKTI 69 
48696483   1 MGIIVNSNHIQSDTLYEYDSFFDIEKVDTFEEGLLSI------QDEPTVLAGFIYdditfnkvinsNSDIDDYIK-NNDI 73 
66394995  74 YYVSDIGLLPDTFITVDsDRKYYSLLQQITELSKDPFP--KWVEDDAKGLTKYYNFQDfEDVFDLNSFYKKEVDMVREKC 151
66391301  70 YWVSNIGTIPSLFKHVD-NSKIKSLLEQAVELLPEEYGvfEYTKESMKKATDYYNFKN-DDYLEEVDIDKDLIDMLAKKC 147
48696483  74 YYVSDIGLLPDTFITVDsDRKYYSLLQQITELSKDPFP--KWVEDDAKGLTKYYNFQDfEDVFDLNSFYKKEVDMVREKC 151
66394995 152 YNNGNVYLLYEVLPDYKLPLAYSLLSNKEHGIVIIGSQTRSNNDILTFYVKGMDAKAIASMFNVEHDYDSNIFHTFVNSH 231
66391301 148 YTNGDLHFLYELDPKLRLPIAYSITRGKDKAIVVIGSQTASDNDMLSFYVKGYDVSKLANTFNAEYEVGNNTFTTFIPSH 227
48696483 152 YNNGNVYLLYEVLPDYKLPLAYSLLSNKEHGIVIIGSQTRSNNDILTFYVKGMDAKAIASMFNVEHDYDSNIFHTFVNSH 231
66394995 232 INILGNQITKFIREKGS 248
66391301 228 INVVGKSIKKYMEDSDV 244
48696483 232 INILGNQITKFIREKGS 248
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap