Conserved Protein Domain Family
PHA02283

?
PHA02283: PHA02283 
hypothetical protein
Statistics
?
PSSM-Id: 107166
View PSSM: PHA02283
Aligned: 3 rows
Threshold Bit Score: 275.478
Threshold Setting Gi: 66395008
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66395008   1 MAKKNVNDVLQQESVTVADKYLQVKVNRDGYTRTHEGQYAYKVVSEGEELFLYPVQTDGKGTLNVMKKSPIAYTDGDNIH 80 
48696481   1 MAKKNVNDVLQQESVTVADKYLQVKVNRDGYTRTHEGQYAYKVVSEGEELFLYPVQTDGKGTLNVMKKSPIAYTDGDNIH 80 
66391310   1 MAKKNVNELLKQEKVEVANKYLQVVTHRDGYTRTHEGQYSYKVVDKSGELFIFPVQTDGYGKLQVMVDSPIAYTNGNNIH 80 
66395008  81 FVVNTVVDPYNHSFIRTEDIKGLDKGKQLIQAFLAFVEDRFKFGVYNVFVANNKEDVLSIVDPTDNDADEVKDSLEHAHE 160
48696481  81 FVVNTVVDPYNHSFIRTEDIKGLDKGKQLIQAFLAFVEDRFKFGVYNVFVANNKEDVLSIVDPTDNDADEVKDSLEHAHE 160
66391310  81 FVVNTLTDPYTQAFIRTEEIKGLDKGKQLIQAFLAFIEDRFRFGVYNVFVV-GKEDAKTVADVAGTDAVKVEEVKGRAFE 159
66395008 161 DVIADFPASPARKDVKGVDSGEGQGDTSEPSAPK---NVQVTPKEDGADVSAE 210
48696481 161 DVIADFPASPARKDVKGVDSGEGQGDTSEPSAPK---NVQVTPKEDGADVSAE 210
66391310 160 DLVVNYPTGNAREDVRHADQSEGMGDTSEPSAPEsptNVQVSPGETSADISAQ 212
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap