Conserved Protein Domain Family
PHA02278

?
PHA02278: PHA02278 
thioredoxin-like protein
Statistics
?
PSSM-Id: 177357
View PSSM: PHA02278
Aligned: 3 rows
Threshold Bit Score: 125.61
Threshold Setting Gi: 48696471
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66395072   1 MNSLVDLNTAIRQKKDVIVMITQDNCGKCEILKSVIPMFqesgDIKKPILTLNLDAEDVDREKAVKLFDIMSTPVLIGYK 80 
66391371   4 VKSLLDLNVQVRQKKDAIALLTQNNCGKCEILKQVIPHL----NLAKPLFVLNLDGKDADREQIINHFDLMSTPVLVGYK 79 
48696471   4 MNSLVDLNTAIRQKKDVIVMITQDNCGKCEILKSVIPMFqesgDIKKPILTLNLDAEDVDREKAVKLFDIMSTPVLIGYK 83 
66395072  81 DGQLVKKYEDQVTPMQLQELESL 103
66391371  80 DGELVKKFEDDVTPQQLQELEDL 102
48696471  84 DGQLVKKYEDQVTPMQLQELESL 106
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap