Conserved Protein Domain Family
PHA02265

?
PHA02265: PHA02265 
hypothetical protein
Statistics
?
PSSM-Id: 164905
View PSSM: PHA02265
Aligned: 3 rows
Threshold Bit Score: 83.2422
Threshold Setting Gi: 66395082
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66395082   1 MSQDKLRAIYTEMKVELHKFPKEVDITSKSTAIAINQILDKFKTLTEQAGKITRKYLEGQEILTIDYEYYDSLQEYYIYL 80 
48696441   1 MSQDKLRAIYTEMKVELHKFPKEVDITSKSTAIAINQILDKFKTLTEQAGKITRKYLEGQEILTIDYEYYDSLQEYYIYL 80 
66391373   1 --MNKKQEVLESMKKELGCLPPSVSMTSKYDALHIHGALEKFKELSDTGSKLTKKYLNGSEILTINYQDFDSMQDYYLYL 78 
66395082  81 LRNSEKIEQSLQEITKRTGEYVK 103
48696441  81 LRNSEKIEQSLQEITKRTGEYVK 103
66391373  79 LRNYSKIKQCLGEITEHFEQRIA 101
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap