Conserved Protein Domain Family
PHA02256

?
PHA02256: PHA02256 
hypothetical protein
Statistics
?
PSSM-Id: 177356
View PSSM: PHA02256
Aligned: 3 rows
Threshold Bit Score: 126.161
Threshold Setting Gi: 66391420
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
48696428   1 MNIITSLSVVFTCLSLLTLMIFVHSKFSSKNVFVLYVIYAIIGIGTYIVLTMFQTTSVLIKNDVIDSIENTEHYIGFNDP 80 
66391420   6 LNILTSILVLIIGTCLLTLVITECLGYTKEFKLLHYAIYGIVIIGTYFLTEMFKKISSIIKEDVILSVQNTEKYTGFNDP 85 
66395065   4 MNIITSLSVVFTCLSLLTLMIFVHSKFSSKNVFVLYVIYAIIGIGTYIVLTMFQTTSVLIKNDVIDSIENTEHYIGFNDP 83 
48696428  81 IIIFTISFIGAILGGIWYKMMKIIKKSNFKDKK 113
66391420  86 TFIFIITTIGAIIGLGIYYTHKYIKEINLNKKR 118
66395065  84 IIIFIISFIGAILGGIWYKMMKIIKKSNFKDKK 116
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap