Conserved Protein Domain Family
PHA02248

?
PHA02248: PHA02248 
hypothetical protein
Statistics
?
PSSM-Id: 134004
View PSSM: PHA02248
Aligned: 2 rows
Threshold Bit Score: 396.003
Threshold Setting Gi: 48696414
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
48696414   1 MKKINSVIKGEGKKVQTADVRKISYYVKDYNPCMTVDDANDYNATSQYLVSDNGKFIAKYNKDMNAVGFYEESGDTVKHL 80 
66395012   1 MKKINSVIKGEGKKVQTADVRKISYYVKDYNPCMTVDDANDYNATSQYLVSDNGKFIAKYNKDMNAVGFYEESGDTVKHL 80 
48696414  81 THTTPERLEGTVFTIEEETEIDLINDTLPQGDILIKFSDGSIYLPDNESVLDSVNYLADNDWDSVDDIIYTGLSKGNSEN 160
66395012  81 THTTPERLEGTVFTIEEETEIDLINDTLPQGDILIKFSDGSIYLPDNESVLDSVNYLADNDWDSVDDIIYTGLSKGNSEN 160
48696414 161 CIVDFNYNNYDIGYDDVEDEDVCDNYPECECSNYCSSTGEYIGN 204
66395012 161 CIVDFNYNNYDIGYDDVEDEDVCDNYPECECSNYCSSTGEYIGN 204
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap