Conserved Protein Domain Family
PHA02246

?
PHA02246: PHA02246 
hypothetical protein
Statistics
?
PSSM-Id: 177355
View PSSM: PHA02246
Aligned: 3 rows
Threshold Bit Score: 163.199
Threshold Setting Gi: 66395017
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66395017   2 DNLSHYLSILYAILITVGYIPGLVALVKAESVKGVSNYFWYLIVATVGISFYNLLLTDASVFQIVSVGLNLTLGIVCLLV 81 
66391315   1 MDIALFFSTMYAILITIGYIPGLKSLVKDRNVDGVSRWFWYLIITTVGISFYNLLHTESTNFQIISVGINLLLGIVCLLV 80 
48696409   2 DNLSHYLSILYAILITVGYIPGLVALVKAESVKGVSNYFWYLIVATVGISFYNLLLTDASVFQIVSVGLNLTLGIVCLLV 81 
66395017  82 ASYRKKDYFSIPFIIVFSLLLFLLSDFTALTQTVATITIILAYVTQITTFYKTKSAEGTNRFLFLIIGLGLASLIVSMVL 161
66391315  81 VVFRKKDLFIFVFIVILSLFLFTFGSKVEVTQTVATLSIILAYISQIIQFYKTKQSDGTNKWLYLIIGFAIGLLSVSMVL 160
48696409  82 ASYRKKDYFSIPFIIVFSLLLFLLSDFTALTQTVATITIILAYVTQITTFYKTKSAEGTNRFLFLIIGLGLASLIVSMVL 161
66395017 162 THTYVHIIATEFVNFVLILICYLQANYYSRG 192
66391315 161 TNTTPHIVITELVNMLLILICYFQADFYEKR 191
48696409 162 THTYVHIIATEFVNFVLILICYLQANYYSRG 192
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap