Conserved Protein Domain Family
PHA02244

?
PHA02244: PHA02244 
ATPase-like protein
Statistics
?
PSSM-Id: 107157
View PSSM: PHA02244
Aligned: 2 rows
Threshold Bit Score: 568.98
Threshold Setting Gi: 157325113
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66394973    1 MAKQDTIERLerlveqqmettkdladklgeknsnpyEQAIVDAIVEKAGTESREIIITDVKKQIEEYVEEQLSNLPvkie 80 
157325113   1 MSIYESIEGL--------------------------EQSIIEGLRTTLETEGKNIALDVIRKELEDSPFLRFFELS---- 50 
66394973   81 lqqEGKTIKDISGI----------FHYRYQDILKLVNQNIPVFLKGGAGSGKNHVLEQVAEALDLDFYFSNAITQEFKLT 150
157325113  51 ---QGSPAGDVYQVdttkiasnptQHYETARVASIVSANVPVWLWGQAGTGKTSIAQSIAKMLDLEFYPMQKIMDEFELK 127
66394973  151 GFIDANGKFHETQFYKAFTKGGLFFLDEMDASIPEVLLILNSAIANKYFDFPIGRVTAHEDFRVVSAGNTMGTGADHIYv 230
157325113 128 GFVDANSRFVPTPLYEAMKNGGLLFIDEIDASVPEALILINTALANNFMRFADETVYAHKDFRVIVAGNTLGKGGNNSY- 206
66394973  231 GRQQLDGATLDRFAQVEFDYDTKVEHQLSS-NEDLVNFVQQLRHENDEKGLPYVFSMRAIINGSKLDGvMEDEFVVESII 309
157325113 207 ARNKIDSATLDRFVPIEIGYDEKIELLITNgDRELVYFVALVRIVMARTKLDHVISYRALSHYKKFES-FGADFLIENVL 285
66394973  310 FKSVPKDEINQFISSLPEGNRYTEATRKLlgmqqepkqeprksdSTSKDSMDFDTIMDKLGLE 372
157325113 286 FKTLSLEDITSIARSLSRVIKETDNDYKW---------------KNNKVGKQLQTYLSNKGVV 333
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap