Conserved Protein Domain Family
PHA02243

?
PHA02243: PHA02243 
hypothetical protein
Statistics
?
PSSM-Id: 107156
View PSSM: PHA02243
Aligned: 3 rows
Threshold Bit Score: 112.501
Threshold Setting Gi: 66395038
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66395038   1 MANEKEIIRMVNYLIDNMSMWHINYARAVLIPSEVEKIIKEHEKFDDLLKKRGEWLVKGSDTDNIDDLETYNQIMNNQKD 80 
48696402   1 MANEKEIIRMVNYLIDNMSMWHINYARAVLIPSEVEKIIKEHEKFDDLLKKRGEWLVKGSDTDNIDDLETYNQIMNNQKD 80 
66391333   1 -MDNKEIKRLFDYLINSSRFWHLEYAKKTLIPSEYNKIVKECDKFDNLLRKRVDNLINNNYKGKPTDIDNYNQIFS--KD 77 
66395038  81 EMMIQEIDIYTQGKTITIDNEHYSSDDLGEVLNKLEQSEDIKIKSNYKSLYVGYTNVVGYEVTYASSYEETFKNDLEKDL 160
48696402  81 EMMIQEIDIYTQGKTITIDNEHYSSDDLGEVLNKLEQSEDIKIKSNYKSLYVGYTNVVGYEVTYASSYEETFKNDLEKDL 160
66391333  78 VLMIKEIKIYTDVDCITISKEDYTKEELDNTIKLLKDGEDIELNSFYKNLFLSSSIIKGYEVEYTSSYEDAIKKG---GI 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap