Conserved Protein Domain Family
PHA02241

?
PHA02241: PHA02241 
hypothetical protein
Statistics
?
PSSM-Id: 107155
View PSSM: PHA02241
Aligned: 3 rows
Threshold Bit Score: 113.278
Threshold Setting Gi: 48696399
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
48696399   1 MKKIYILEEEIEEMDYDL-WEEDTVYTT-SYEILGYTDSLEDAEYIRDNYGTS--NPIFINEYPYITKEKLIEEQRYFRY 76 
66391322   1 MAKLYALIKVSEYTHTNVgWDEYFEYTTdNTEILGYSTNLEELEYIQSNYDLEvyEELFVREINEITKEDFIKEQRYIKY 80 
66395019   1 MKKIYILEEEIEEMDYDL-WEEDTVYTT-SYEILGYTDSLEDAEYIRDNYGTS--NPIFINEYPYITKEKLIEEQRYFRY 76 
48696399  77 NSYIELKRVNGYFEISEINDLQVTEDFSINKDDKNFDSpFSINMFSHNRNSIGIEFIMFSEYDDKEDIIEKEKNSFLMKL 156
66391322  81 SSWIELKRNNGHFVHDNIIKNEPYEVFSVDKNSYSLDT-IIIDVHISDRNTITIFVEMRSEYSDMEDVFISTVDSYVNKL 159
66395019  77 NSYIELKRVNGYFEISEINDLQVTEDFSINKDDKNFDSpFSINMFSHNRNSIGIEFIMFSEYDDKEDIIEKEKNSFLMKL 156
48696399 157 KYLLKHSKEADIRSTSKIIDSIDKLT 182
66391322 160 NFLLSNLKNADVRSTRKVVESIKKLK 185
66395019 157 KYLLKHSKEADIRSTSKIIDSIDKLT 182
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap