Conserved Protein Domain Family
PHA02239

?
PHA02239: PHA02239 
putative protein phosphatase
Statistics
?
PSSM-Id: 107154
View PSSM: PHA02239
Aligned: 3 rows
Threshold Bit Score: 484.884
Threshold Setting Gi: 66395000
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66395000   1 MAIYVVPDIYGEYQKLLTIMDKINNERKPEETIVFLGDYVDRGKRSKDVVNYIFDLMSNDDNVVTLLGNHDDEFYNIMEN 80 
48696397   1 MAIYVVPDIHGEYQKLLTIMDKINNERKPEETIVFLGDYVDRGKRSKDVVNYIFDLMSNDDNVVTLLGNHDDEFYNIMEN 80 
66391303   1 MSIFVIPDIHGEYDKLMRLMNKIIEERKPEDTIVFLGDYIDRGDRSKDVVNYLFDLLLNDENVVALLGNHDDELYRIIEN 80 
66395000  81 VDRLSIYDIEWLSRYCIETLNSYGVSTVTLKYSSVEENLRNNYDFIKSELKKLKESDDYRKFKILMVNCRKYYKEDKYIF 160
48696397  81 VDRLSIYDIEWLSRYCIETLNSYGVSTVTLKYSSVEENLRNNYDFIKSELKKLKESDDYRKFKILMVNCRKYYKEDKYIF 160
66391303  81 IDRLGIYDIEWLSRYCMETLDSYGVDIATLTCNIVEDVLRNDYDFIKNELNKLKESEDYRKFKVFMTNCRRYYKKDKYIF 160
66395000 161 SHSGGVSWKPVEEQTIDQLIWSRDFQPRKDGFTYVCGHTPTDSGEVEINGDMLMCDVGAVFRNIDFPFIKLEVKK 235
48696397 161 SHSGGVSWKPVEEQTIDQLIWSRDFQPRKDGFTYVCGHTPTDSGEVEINGDMLMCDVGAVFRNIDFPFIKLEVKK 235
66391303 161 THSGGVSWKPVEGQTVDQLMWSRDFQPRKDGFIHVCGHTPTSSGQVEKHNDMLLCDVGAVFRDIELPFIKLEELE 235
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap