Conserved Protein Domain Family
PHA02152

?
PHA02152: PHA02152 
hypothetical protein
Statistics
?
PSSM-Id: 107153
View PSSM: PHA02152
Aligned: 3 rows
Threshold Bit Score: 89.0262
Threshold Setting Gi: 66392050
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66392050   1 MSSPFTVEFYNDRNEKVDVRYGNHGWVSPSNIRYAENIINVVNGARFGEENKPVAEWFYFISSGRVYFKEDYDKMATIVG 80 
37651732   1 MSSPFTVEFYNDRNEKVDVRYGNHGWVSPSNIRYAENIINVVNGARFGEENKPVAEWFYFISSGRVYFKEDYDKMATIVG 80 
109290223  1 MSSPFSIVFYKD-DDIVGSGYGNHGWISPNDLQKAKSIIAVVEGTSW-QLGPFEKEWTHFIAAGRAFYAQDYEKMKQIIY 78 
66392050  81 LIKTFDPYEFSMELKQ 96 
37651732  81 LIKTFDPYEFSMELKQ 96 
109290223 79 LIESFDLSDFSLSYSE 94 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap