Conserved Protein Domain Family
PHA02151

?
PHA02151: PHA02151 
hypothetical protein
Statistics
?
PSSM-Id: 177354
View PSSM: PHA02151
Aligned: 3 rows
Threshold Bit Score: 450.946
Threshold Setting Gi: 37651731
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66392049    1 MIPMAVRERIFTQLRHMQSFTIELIMHQIHSRLAKEPREWTSFFDRRMARIDSTVDYAIKEHAKAGGTLSKAEIAERTGR 80 
37651731    1 MIPMAVRERIFTQLRHMQSFTIELIMHQIHSRLAKEPREWTSFFDRRMARIDSTVDYAIKEHAKAGGTLSKAEIAERTGR 80 
109290222   2 TVPMNVSHDEFIALRHIQPFDADIIRLQICDQLKKQPDTRDELFEKRKRRYDDTIQYALDE--AAGKDIPRQEVIDRTVH 79 
66392049   81 SLDAELGIAYILGGLTGVMAWLDNDDITFDVPTPDFNLEIKTSFNRWPTMHTAGAEPYGRADGLCLYAGYKGNADVFLVL 160
37651731   81 SLDAELGIAYILGGLTGVMVWLDNDDITFDVPTPDFNLEIKTSFNRWPTMHTAGAEPYGRADGLCLYAGYKGNADVFLVL 160
109290222  80 SLNAEMGVAYILGGVWGVFDWLDNDNITFDVPTPGFNLEIKTSFAKWPTMHTAGAKPYGKSEGLCLYSGCRGDADVYLVL 159
66392049  161 HMENVDGQTYFNPNYFFTKRAMEKYPYEIATRRMVDGAYINRNHDRYVHFYKKWCTL 217
37651731  161 HMENVDGQTYFNPNYFFTKRAMEKYPYEIATRRMVDGAYINRNHDRYVHFYKKWCTL 217
109290222 160 NINEYAGRVTYRPNYFFTKRAMENYPYVICVPKRGGGAYVNRQHNKFVYFYNKWCTF 216
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap