Conserved Protein Domain Family
PHA02150

?
PHA02150: PHA02150 
hypothetical protein
Statistics
?
PSSM-Id: 134001
View PSSM: PHA02150
Aligned: 3 rows
Threshold Bit Score: 135.519
Threshold Setting Gi: 66392045
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
37651727   1 MLYRFVSEEQFNAWSSQNYAKEFAKHFKKWDDVFATEDLSCEGMTDWAEINGQYICSSHWYPFVSDDLGSRLVEVEA 77 
66392045   1 MLYRFVSEEQFNAWSSQNYAKEFAKHFKKWDDVFATEDLSCEGMTDWAEINGQYIRSSYWYPFVSDDLGSRLVEVEE 77 
109290219  2 VKYRFVSEEQFNAWAKQNYAQEFAFAFDSWDTIFEMEDIGRKVCSDTIEIDGEIYMSTQWYPFNITDLGNRIIEVKE 78 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap