Conserved Protein Domain Family
PHA02148

?
PHA02148: PHA02148 
hypothetical protein
Statistics
?
PSSM-Id: 107150
View PSSM: PHA02148
Aligned: 3 rows
Threshold Bit Score: 82.595
Threshold Setting Gi: 66392030
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66392030    1 MNDKSWNLIKMFqmKKTKIEPTVTplPISDLKVEAFELFKKIEERIAHDQTRLEELAKSRENELRRHEAAIRLAMDSHSI 80 
109290208   1 MNPKNGLIMKYF--GSAEVKPQIP--TVEGIRANALEIFKQLEDRIATDSQTLDQIATRRQNELQAHELAVKNLMERHSA 76 
37651710    1 MNDKSWNLIKMFqmKKTKIEPTVTplPISDLKVEAFELFKKIEERIAHDQTRLEELAKSRENELRRHEAAIRLAMDSHSI 80 
66392030   81 KMDDLSLQEALISDSLKGGKYLKNIVAQAC 110
109290208  77 IMNNLSAEQTLVSDSIKAAQVMKANIAQIC 106
37651710   81 KMDDLSLQEALISDSLKGGKYLKNIVAQAC 110
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap