Conserved Protein Domain Family
PHA02145

?
PHA02145: PHA02145 
hypothetical protein
Statistics
?
PSSM-Id: 107148
View PSSM: PHA02145
Aligned: 3 rows
Threshold Bit Score: 409.352
Threshold Setting Gi: 109290199
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
37651703    1 MSQRHGRFWSIGFNAVGYTGSLPAPNWGTQIRRFAGLNPVGNGLDPALSEFYFGQGAQPAGRWMSQYFNRGRTPSRCFMW 80 
109290199   1 MSQRHGRFWSIGYNAIGYTGDIKKPNWFTNVRRFAGLSAAGNAADPQLSSFYFGQGASPNGRWASSYFNKSRSPSRCYMW 80 
66392023    1 MSQRHGRFWSIGFNAVGYTGSLPAPNWGTQIRRFDGLNPVGNGLDPALSEFYFGQGVQPAGRWMSQYFNRGRTPSRCFMW 80 
37651703   81 SGSRYPYNSWSGFDWGGELTQIANATIKIGWIGTGRASHRGGD----MGYINLRWKWDNDLWQETRIFTTPDTYVSDWYG 156
109290199  81 SGSRYPYNRNQNFSYSTEFTQVQRATIKIGYIGTGGASHRDGEntktAGYINLRWRWDNQPWQETRVYTTPTQYVSDWYG 160
66392023   81 SGSRYPYNSWSGFDWGGELTQIANATIKIGWIGTGRASHRGGD----MGYINFRWKWDNDLWQETRIFTTPDTYVSDWYG 156
37651703  157 NRVMNLNRPgGGRGTLTFKIVGNVGDFDQHDVGDRGPNASWSPVVDMSVAGSG----YQGELFKSFQGHQTRQYNENN 230
109290199 161 SRTFNFTHP-TGRGRIQFEVFGNYGDFDQHDVGDRGKDSSWSPYLNMALPGAGhlaaYNGELFKSFSGHQTREYSENN 237
66392023  157 NRVMNLNRPgGGRGTLTFKIVGNVGDFDQHDVGDRGPNASWSPVVDMSVAGSG----YQGELFKSFQGHQTRQYNENN 230
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap