Conserved Protein Domain Family
PHA02142

?
PHA02142: PHA02142 
putative RNA ligase
Statistics
?
PSSM-Id: 134000
View PSSM: PHA02142
Aligned: 4 rows
Threshold Bit Score: 509.487
Threshold Setting Gi: 189490507
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
37651690    1 MIINDERQLASMRKIADLQPIPGADAIEVATIDGWEVVVKKGEFRVGSDCVYFEIDSLLPTDHPAFRFLETRA---KIYD 77 
109290186   1 MIINNERQLASIRKIADLQPIPGADAIECATIDGWEVVVKKGEFTIGDDCVYFEIDSMLPMDNPAFKFLESRA---RMYE 77 
66392010    1 MIINDERQLASMRKIADLQPIPGADAIEVATIDGWEVVVKKGEFRVGSDCVYFEIDSLLPTDHPAFRFLETRA---KIYD 77 
189490507   8 AVVENTRKLVRVVKVDAITPIKKADFIELAKIDGWQCVVKKDEFKAGDLAVYAEIDSLLPLDNPLFAFLGERSdgkRTFD 87 
37651690   78 GKMRARIKTIKLRGQISQGIALPTGAFTVGELLggqemDKTIDQMLDIIKYEPPQDGTGCNPGG---------------- 141
109290186  78 GKMRARVKTIKLRGQLSQGIALPINAFTIGELL-----DQSLDQILGIIKYEPAQDGSGCNPAG---------------- 136
66392010   78 GKMRARIKTIKLRGQISQGIALPTGAFTVGELLggqemDKTIDQMLDIIKYEPPQDGTGCNPGG---------------- 141
189490507  88 GVAYSRIRTAKMRGEVSQGLLLP-----LPEQFkgkkvGTNLTNELGVRKLEAEIANVDGFDGRlnkdgpislwerlarf 162
37651690  142 -----------TFPIFIPKTDEERCQNIFNRYKEKYAD-VKFAKSLKLDGSSITMAWVTDPE------------------ 191
109290186 137 -----------TFPVFIPKTDEERCQNIFTKYSACYKD-VVFQKSLKLDGSSITMAWVTDPD------------------ 186
66392010  142 -----------TFPIFIPKTDEERCQNIFNRYKEKYAD-VKFAKSLKLDGSSITMAWVTDPE------------------ 191
189490507 163 vagppaeamhlPFPAQISKSDQERVQNIGNQYAEAAASgETFEETVKVDGQSMTVYSFRDMDeagpirrygvcsrnfdmr 242
37651690  192 ----------------------------------LFLDLGTEEEPYAHDYDDAQF--------------IVASRNQVLRY 223
109290186 187 ----------------------------------LFLELGTEDEPYAHDYDDAQF--------------ILASRNQVLRY 218
66392010  192 ----------------------------------LFLDLGTEEEPYAHDYDDAQF--------------IVASRNQVLRY 223
189490507 243 mtdvvftpvqafrrfvaqnmlalsggfsglfrtaQFLTKQVMDKKLDADYAIKEYftkryfwfspfkmcIAAMDDNCVNY 322
37651690  224 NADSKWWKGVENYQIVDRLKELRMSVAIQGELMGPGIQKNRENFDKYRIFAFRAFFIDEQRFATDEEFQDLCRTLGMEIC 303
109290186 219 NPESKWWMGVENYQIIEQLKKMGKSVAIQGELMGPGIQKNRENFDKYRIFAFRAWFIEEQRFATDEEFHDLCRALGMEMV 298
66392010  224 NADSKWWKGVENYQIVDRLKELGMSVAIQGELMGPGIQKNRENFDKYRIFAFRAWFIDEQRFATDEEFQDLCRTLGMEIC 303
189490507 323 VITNKVLDKLAAYNVLHD-----DCITVQGELFGPGIQKNYERPAEKRFAVYQV-YRNGSEWVKPIEARAITESIGLEYV 396
37651690  304 PQLGYSYPFQEFTNVKDMLAAAD--------------IPSIEHKIAEGVVYKSVELVDGRMVHFKAINNKFLLKCED 366
109290186 299 PQLGRCKPFEQFETVKEMLADAD--------------IPSINHKIAEGVVYKSVDLVNGQMIHFKAINNKFLLKCED 361
66392010  304 PQLGYSYPFQEFTNVKDMLAAAD--------------IPSIEHKIAEGVVYKSVELVDGRMVHFKAINNKFLLKCED 366
189490507 397 KVLNGSTTLPK--SVKEVLTRAKgkgayaafdpsinaVPDINR---EGIVFKS----NTRDFSFKVISTEYLLEAEA 464
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap