Conserved Protein Domain Family
PHA02141

?
PHA02141: PHA02141 
hypothetical protein
Statistics
?
PSSM-Id: 177353
View PSSM: PHA02141
Aligned: 3 rows
Threshold Bit Score: 139.068
Threshold Setting Gi: 109290177
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66392004    1 MLPSLSSTISWLRNNVLYMIIIGLLGWMIKNQSEQIDNLETKIETIQKFQASSVENAKPVQEAMLKAPKATRQMEKIAEK 80 
109290177   1 MLLTLSSLLSWLKSNALYIIIMVLMAIMMKNQHDEISTLKTSLESMKSFQTKSYENAKPVTEALLKSPKATKQMEKIAEK 80 
37651683    1 MLPSLSSTISWLRNNVLYMIIIGLLGWTIKNQSEQIDNLETKIETIQKFQVSSVENAKPVQEAMLKAPKATRQMEKIAEK 80 
66392004   81 KPQLLEKHMNTGFRQLTDKIQETTK 105
109290177  81 KPQLLEKRMNMGFQKLADQLQESTK 105
37651683   81 KPQLLEKHMNTGFRQLTDKIQETTK 105
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap