Conserved Protein Domain Family
PHA02130

?
PHA02130: PHA02130 
hypothetical protein
Statistics
?
PSSM-Id: 107142
View PSSM: PHA02130
Aligned: 3 rows
Threshold Bit Score: 157.878
Threshold Setting Gi: 37651604
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
37651604   1 MKTISPTGKEKTFKSWESLREWLDERFDSWDDDILSIPFKSTVYWDLCPYAQDIHNGQENLVWNTDKDELEKQLELIAEE 80 
66391925   1 MKTISPTGKEKTFKSWESLREWLDERFDSWDDDILSIPFKSTVYWDLCPYAQDIHNGRENFVWNTDKDALEEHLKMIAQE 80 
109290099  1 MKTISPAGKEKTFKSCQSLKDWLSANCDSWDDDILDIPFKSTVHWGLCPFDQDIYNGKETFVWNFCKTLLEKELESRAQE 80 
37651604  81 I 81 
66391925  81 I 81 
109290099 81 I 81 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap