Conserved Protein Domain Family
PHA02128

?
PHA02128: PHA02128 
hypothetical protein
Statistics
?
PSSM-Id: 107141
View PSSM: PHA02128
Aligned: 3 rows
Threshold Bit Score: 311.225
Threshold Setting Gi: 37651595
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66391916    1 MSIVKERFFNYKTFFIDAINRSYANKPSGCIQEMSQPKSSFLREHRTIHLNLGRMTGKTTGLLHLANEVSAQGGARIITM 80 
37651595    1 MSIVKERFFNYKTFFIDAINRSYANKPSGCIQEMSQSKSSFLREHRTIHLNLGRMTGKTTGLLHLANEVSAQGGARIITM 80 
109290092   1 MSIVKERFFNYKTFFVEAINRAYDNFPAGCSQELYQPKSSFLREHRTIHLNLGRITGKTSGLIQLANELVAQGGVRLITM 80 
66391916   81 NSANKRHVQDMVSYQWRGDIRISTISELTDRCPKVKFLMIDESEYTLTSRHQRQEIYDWAGTHGVEFVIMT 151
37651595   81 NSANKRHVQDMVSYQWRGDIRISTISELTDRCPKVKFLMIDESEYTLTSRHQRQEIYDWAGTHGVEFVIMT 151
109290092  81 NPANKRHVKDMVLGPWRGDIQISTMSELTNHCPCVKFLMIDESEYTLTSRHHRQEIYDWAGTHGVEFVIMT 151
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap