Conserved Protein Domain Family
PHA02125

?
PHA02125: PHA02125 
thioredoxin-like protein
Statistics
?
PSSM-Id: 133998
View PSSM: PHA02125
Aligned: 3 rows
Threshold Bit Score: 151.669
Threshold Setting Gi: 109290085
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
109290085  1 MIYLFGADWCAKLQTRKNLcLPNVDYKYIDVDSDEGIALTAKYAIRGLPTMINVETTDRFTGVPKNVVELKQKMGI 76 
37651590   1 MIYLFGAEWCANCKMVKPM-LANVEYTYVDVDTDEGVELTAKHHIRSLPTLVNTSTLDRFTGVPRNVANLKEKLGI 75 
66391911   1 MIYLFGAEWCANCKMVKPM-LANVEYTYVDVDTDEGVELTAKHHIRSLPTLVNTSTLDRFTGVPRNVADLKEKLGI 75 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap