Conserved Protein Domain Family
PHA02123

?
PHA02123: PHA02123 
hypothetical protein
Statistics
?
PSSM-Id: 107137
View PSSM: PHA02123
Aligned: 3 rows
Threshold Bit Score: 217.283
Threshold Setting Gi: 37651586
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
109290080   1 MKKSIAAILALSIYGCGAAAPVTANMNEMFWFPEKSGVIKEFTDENGKYESALSVSCDMQYTQKHDDCLGIIFNSDYWII 80 
37651586    1 MKKSIATLIAIGMYGCSAVAPVTANVNEMFHFPQKSGVIQEFTDENGTYESALSASCDREVREQYDNCLGIVFNSDYWLI 80 
66391907    1 MKKSIATLIAIGMYGCSAVAPVTANVNEMFHFPQKSGVIQEFTDENGTYESALSASCDREVREQYDNCLGIVFNSDYWLI 80 
109290080  81 DSARSDNSILSRSERVMISFDGVVQNVYYVRTGSAIVIWRKDNPDFNPMGKVMSITTPYGKGEFTL 146
37651586   81 DGARDDKNILVGTERVMISLNGIVQNVDYIRSGSAIVIRRMDNPTFNPIGDVLSITTSSGKGEFTL 146
66391907   81 DGARDDKNILVGTERVMISLNGIVQNVDYIRSGSAIVIRRMDNPTFNPIGDVLSITTSSGKGEFTL 146
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap