Conserved Protein Domain Family
PHA02122

?
PHA02122: PHA02122 
hypothetical protein
Statistics
?
PSSM-Id: 177352
View PSSM: PHA02122
Aligned: 3 rows
Threshold Bit Score: 112.284
Threshold Setting Gi: 37651584
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66391905   1 MAANKWQKPGPVMNRVFEEAFIGLLGDGCENIIIHSFKDDGDEVIVNFELVVDGKLIINQTRLIA 65 
37651584   1 MAANKWQKPGPVMNRVFEEAFIGLLGDGCENIIVHSFKDDGDEVIVNFELVVGGKLIINQTRLIA 65 
109290078  2 EVKGKWQQCGPVMQKVFEAAFIHLFGPDLDGVIIHSYREVGDCVKVNYEIKHNGQLFIGQTVIVE 66 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap