Conserved Protein Domain Family
PHA02118

?
PHA02118: PHA02118 
hypothetical protein
Statistics
?
PSSM-Id: 107134
View PSSM: PHA02118
Aligned: 3 rows
Threshold Bit Score: 330.543
Threshold Setting Gi: 109290071
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
37651577    1 MQKQLKMGIMAAFVSAALSGCGQANTDDTFTYNGLGGEATPTVTAVSAQQCAELGGGSLEQCQSAFDKAKMEHIDSAPKF 80 
66391898    1 MQKQLKMGIMAAFVSAALSGCGQANTDDTFTYNGLGGEATPTVTAVSAQQCAELGGGSLDQCQSAFDKAKMEHIDSAPKF 80 
109290071   1 MQKQMKMGIMAAFVAAALSGCGEQQS-DTFSYNGLGGESTPTVTATSAEQCQELGGGSMEQCQLAFKQAKDEHTSAAPKF 79 
37651577   81 NDQASCESGTEAICNRTQIQNSDGSFSDVFVPAMVGMIVGQMMSNNSRPMPVYAPARPEDRKNGFVTSGGAYVPPAKGSV 160
66391898   81 NDQASCESGTEAICNRTQIQNSDGSFSDVFVPAMVGMIVGQMMSNNSRPMPVYAPARPEDRKNGFVTSGGAYVPPAKGSV 160
109290071  80 DDQTSCESGTGTVCTQTQIQNSDGSFSDVFVPAMVGMIVGQMMSSNARPMPVYAPSRSEDRRNGFVTANGSYVPPGKGSI 159
37651577  161 GANTFSAPKTPGSFSKPSPSSKPSFS-SKGGFGKSGSFGSSGG 202
66391898  161 GANTFSAPKTPGSFSKPSPSSKPSFS-SKGGFGKSGSFGSSGG 202
109290071 160 GANTFKTSFGKGSFAKPAASSKPVVRmSSGGFGKSGGFGSSGG 202
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap