Conserved Protein Domain Family
PHA02117

?
PHA02117: PHA02117 
glutathionylspermidine synthase domain-containing protein
Statistics
?
PSSM-Id: 177351
View PSSM: PHA02117
Aligned: 5 rows
Threshold Bit Score: 534.084
Threshold Setting Gi: 282599028
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
37651574    1 MKRLSIEARKDWLPQLTSEGVLWTTTEEGP---------YWSEAMAKPVYYSFTKAEQQELELAANTLHGMCIDTLRWFF 71 
66391895    1 MKRLSIEARKDWLPQLTSEGVLWTTTEEGP---------YWSEAMAKPVYYSFTKAEQQELELAANTLHGMCIDTLRWFF 71 
109290070   1 MKRVSIEARKDWLPQLTSEGVLWTTTEEGP---------YWTEAMVQPKYYSFTRKEQEQLEKAANEIHEMCLETIEWLF 71 
189426829   1 MRRIKQVERPDRAAKLESIGLSFHSWDD-----------YWNEGVA----YEFSSAQIDELERATNELHDMCSKAIGHVL 65 
282599028   7 IANVSLNMGEIVDQELPNVSLFYSNGQGDLkqdakelfeYMIKNNGRLPIYSIDQASVDSIMGTAGAAYAAMGHALDIMF 86 
37651574   72 E---------EASFAQRLRVWDMFNIPENARQMIIDSWSADEWGFYGRFDFIMTKDG---PKMLEYNADTPTILIES--- 136
66391895   72 E---------EASFAQRLRVWDMFNIPENARQMIIDSWDADEWGFYGRFDFIMTKDG---PKMLEYNADTPTILIES--- 136
109290070  72 T---------RDS-KKQNEIFDMFNIPYESRDQIMRSWEDDEWGLYGRFDFIMTENG---PKLLEYNADTPTILIES--- 135
189426829  66 C---------YNRLGE-------LGIPEAFWKPIERSFKNCDWSLYGRFDLVYDGVRp--PKMLEYNADTPTSLLES--- 124
282599028  87 SmndddikqwYPCEASRHPAFDGFLL------MAKHTWTERHPTVYGRFDLAINPNLgtvKGIYEFNGDTPVMLFESvnl 160
37651574  137 -------------SISQWNWFTQNNf---PNHYQFNEIHESLVNHWADMKKLNGLNGCLNIVATSQVDDFATIAYIGETA 200
66391895  137 -------------SISQWNWFTQNNf---PNHYQFNEIHESLVNHWADMKKLNGLNGCLNIVATSQVDDFATIAYIGETV 200
109290070 136 -------------AISQWNWFNDQHekfhQEAFQFNEIHEALVNHWRDMSTLYAIGDKISFVATTQVDDFATIAYMAETA 202
189426829 125 -------------AVAQWYWLQDVH----PQRDQFNSIHERLVARWKQVPYVSAQTIHFASLKDNE-EDWVCTHYLMDTA 186
282599028 161 qnmisekmdrpddQANRW-WLDTAG-----RRQEFTGKKVAIV------------------CDPGFIEDTVSCDTLAQAL 216
37651574  201 AEAGIPVNVFDISEIQ---MSDAGRFY-DQQDRLMEYCFKLYPWEWMMEDEFGAYAH------KSGTRFIEPAWKMMLSN 270
66391895  201 AEAGIPVNVFDISEIQ---MSDAGRFY-DQQDRLMEYCFKLYPWEWMMEDEFGAYAH------KSGTRFIEPAWKMMLSN 270
109290070 203 SEAGLNVKMFDIAEIQ---LSDDGNFY-DIEGQHIDTCFKLYPWEWLYEDDFGKAIG------GSNTRFIEPTWKMMLSN 272
189426829 187 VQAGYKVKHVWVEDLG---WREGSKYFvDLEDAPIHVLFKLYPWEWMMREEFSAHLL------DTRTHLIEPMWKSVLSN 257
282599028 217 TEAGAVTYFTDIQSFNhdvLSLRKPFFvEGVDAPVDMAFMLLPWEEMIIGEKSQEILvhweqwVDQVKFLEPAWRWFMSH 296
37651574  271 KALLVLL----------YERYPNCKWLVPAYEEDDFDRLNLFTFENPK-WVSKPLLSREGSNVHIFEYGGESESTDGNYA 339
66391895  271 KALLVLL----------YERYPNCKWLVPAYEEDDFDRLNLFTFENPK-WVSKPLLSREGSNVHIFEYGGESEFTDGNYA 339
109290070 273 KALLVLL----------YERYPDCEWLVPAYMEDDFDRFNLFTYENPK-WVSKPLLSREGCNVHIFEYGGESEFTDGNYA 341
189426829 258 KGLLAIL----------WELYPDHPNLLPAYLGDPRTLTS---------YAKKPLFSREGANIELWDNDRVVAADRGPYG 318
282599028 297 KGFMAWMtwliqndeefRDKWGDLPFLETYLVDDQNSYEQVARLEQSGnYVLKPVTGRLSNNIQVFEQGQQQTDTGGHYS 376
37651574  340 EEPRIVQEYIEWQEFDGCYPMIGVWMVGDDAVGLGIRE-DDGRITGNNSRFIPHVVEN 396
66391895  340 EEPRIVQQYIEWQEFDGCYPMLGVWMVGDDAVGLGIRE-DDGRITGNNSRFIPHVVEN 396
109290070 342 EEPRIVQEYIEWKDFDGCYPMLGVWMVGSDAVGLGIRE-DDSRITGNNSRFIPHVVEN 398
189426829 319 AEGHVYQQLAPLPNFDGNYPVIGSWIVGSEAAGICVRE-DNQLITTNLSHFVPHYF-- 373
282599028 377 DEPMVIQALCRPGRIDGANFIAGVWLADTEPASLCFREfDSPVLSIANERFKAHVIDG 434
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap