Conserved Protein Domain Family
PHA02115

?
PHA02115: PHA02115 
hypothetical protein
Statistics
?
PSSM-Id: 164902
View PSSM: PHA02115
Aligned: 3 rows
Threshold Bit Score: 189.126
Threshold Setting Gi: 109290066
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66391890    1 MNIQKEIQEIEKRLGVEASEFKMPSVWKVARKPEWSYGAVFEQEFTAYEHKELGCFVAVYSERHRAQFVNTEGEDVIGHT 80 
37651568    1 MNIQKEIQEIEKRLGVEASEFKMPSVWKVARKPDWSYGAVFEQEFTAYEHKELGCFVAVYSERHRAQFVNTEGEDVIGHT 80 
109290066   1 ---------MSKQIGVEASEFKIPPIWKIVRKPGWSYGLSFEREFTVYEHKEMGYTIAIHSERHRAQFVNENNEDVMGFA 71 
66391890   81 ERVVSVQHVEPYKTRLGTSWRVVNA 105
37651568   81 ERVVSVQHVEPYKTRLGTSWRVVNA 105
109290066  72 EMIVSVSEVEPHKSKHGTRWQFV-- 94 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap