Conserved Protein Domain Family
PHA02114

?
PHA02114: PHA02114 
hypothetical protein
Statistics
?
PSSM-Id: 107131
View PSSM: PHA02114
Aligned: 3 rows
Threshold Bit Score: 241.024
Threshold Setting Gi: 109290065
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
109290065   1 MQIILKSAGEGKTAEAIKSAYMAAMNHPVLIVSSKEHPSVLEHRVNMFSIQNPAIKNRYDIVTCVEPATPEMFKDLGYFD 80 
37651567    1 MKLILRTANAGKTQEAIKSAFEAAQHHEVMFVSDEMPYTEILRRLTAFSSENPAMQNRYIISTALAQAKPEMFDDLEAFD 80 
66391889    1 MKLILRTANAGKTQEAIKSAFESAQHHEVMFVSDELPYTEILRRLNAFSSENPALQNRYIISTSVLPADPEMFDNLTAFA 80 
109290065  81 RFGTIILDVNFAMSRGPWITVCAELEAYGYEVIATQELVKPAQKShkvYH 130
37651567   81 QYGTIVLDVNYAMSRAPWIKVISRLEEAGFNVVATQMLVKPVAPT---FH 127
66391889   81 QYGTIVLDVNYAMSRAPWIKVISRLEEAGFNVVATQQLLKTSAPT---FH 127
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap