Conserved Protein Domain Family
PHA02108

?
PHA02108: PHA02108 
hypothetical protein
Statistics
?
PSSM-Id: 177349
View PSSM: PHA02108
Aligned: 3 rows
Threshold Bit Score: 53.4235
Threshold Setting Gi: 109290054
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
37651555   1 MSTKNIVINAGYIASFGLFYAMYKGDAYFVLGCAAAVIGSTIIARLIK 48 
109290054  1 MSIKAAAINIGYIASFALFYSMYIGNAYAVLGCAMAVIGSTIIARICE 48 
66391877   1 MSTKNIVINTGYIASFGLFYAMYKGDAYFVLGCAAAVIGSTIIARLIK 48 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap