Conserved Protein Domain Family
PHA02107

?
PHA02107: PHA02107 
hypothetical protein
Statistics
?
PSSM-Id: 164900
View PSSM: PHA02107
Aligned: 3 rows
Threshold Bit Score: 373.181
Threshold Setting Gi: 109290053
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66391876    1 MTKHKDLNRFLKNTHDTTGNKYRKSRDLNSRFADKHHFMRLLNNLLPSEMKWSSFGSRFGIAKISPNHINLAAVGTHSVC 80 
109290053   1 MNYYAAVKNFLENRRDTSNNRFKTYKPVTERLANYHHFMKLVNDILPNLMPTSALGKHNGISKIKPNYFNVDAENAVTVK 80 
37651554    1 MTKHKDLNRFLKNTHDTTGNKYRKSRDLNSRFADKHHFMRLLNNLLPSEMKWSSFGSRFGIAKISPNHINLAAVGTHSVC 80 
66391876   81 GTIWVNTSFESDCVTNRLQTLEAYGVFVEVARRTNGSNHVVTFSVDLPNGDKapVKNVETKTEVVSTVDYTEP----AKE 156
109290053  81 GIIWLNTVFEADCFAARLELLRHYGAVVKIDISENGRNQIVKFSIILSEIEH--VKPVAEDANNVEEARSAEPvnleTEK 158
37651554   81 GTIWVNTSFESDCVTNRLQTLEAYGVFVEVARRTNGSNHVVTFSVDLPNGDKapVKNVETKTEVVSTVDYTEP----AKE 156
66391876  157 PDGQNIFFAPETMRAVQLVRGVFHFASVRISEIDEEIKELQARRKEIEDNIKSIKNAIGA 216
109290053 159 EICESIFFSEAIGKAIHTIRGALNFGSKRLKEIDCEIAKLQALRKEVEDNMKIIKNSIGA 218
37651554  157 PDGQNIFFAPETMQAVQLVRGVFHFASVRISEIDEEIKELQARRKEIEDNIKSIKNAIGA 216
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap