Conserved Protein Domain Family
PHA02106

?
PHA02106: PHA02106 
hypothetical protein
Statistics
?
PSSM-Id: 177348
View PSSM: PHA02106
Aligned: 3 rows
Threshold Bit Score: 96.7234
Threshold Setting Gi: 37651551
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
37651551   1 MNRIKELFDKAVKWYEQEWYYGKWIVSGNADSYLVKYLTFDGEFGLVPSFYSQYYDGHKLNRLRLFVVSIEWGHVVYSKN 80 
66391873   1 MNRIKELFDKAVKWYEQEWYYGKWIVSGNADSYLVKYLTFDGEFGLVPSFYSQYYDGHKLNRLRLFVVSIEWGHVVYSKN 80 
109290051  1 ------MFNKIIKWYEQEWLYKKKIIYEWKNSYLVKYFSIDGEFGHLPSYWGQMYNGYKLNRLRLFIVSIEWGHIVMSKA 74 
37651551  81 QWEKEMKCKSN 91 
66391873  81 QWEKEMKCKSN 91 
109290051 75 EWESNANQTDK 85 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap