Conserved Protein Domain Family
PHA02104

?
PHA02104: PHA02104 
hypothetical protein
Statistics
?
PSSM-Id: 177347
View PSSM: PHA02104
Aligned: 3 rows
Threshold Bit Score: 142.894
Threshold Setting Gi: 109290049
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
37651549   1 MNMDINDYAKEFTREIGRNIHVNLLSTDPEQVKSTIFWTFPGITEVRIGSSTYFAQNGKIYNATIDYNAKRVIMAGEANA 80 
66391871   1 MNMDINDYAKEFTREIGRNIHVNLLSTDPEQVKSTIFWTFPGITEVRIGSSTYFAQNGKIYNATIDYNARRVIMAGEANA 80 
109290049  1 --MHIHNHAKEFTRVIGGNIRVNLLSTDHEQIKNTIYWAFPDIEEVEIGNSKYFAHHGKIYNATIDYNAKQVIMVAK--- 75 
37651549  81 ETNTEIYTV 89 
66391871  81 EINTEIYTV 89 
109290049    ---------    
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap