Conserved Protein Domain Family
PHA02101

?
PHA02101: PHA02101 
hypothetical protein
Statistics
?
PSSM-Id: 177345
View PSSM: PHA02101
Aligned: 3 rows
Threshold Bit Score: 199.419
Threshold Setting Gi: 109290040
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
109290040   1 MMFEEAKELINRPPKLFFGKEYDGTHVGSILEKIQKYNGPGDAYRVEYRVLLDGGNVVTGVGIANYSWIAKVGYRPDVEI 80 
37651540    1 MMFTEAKCIVNRPRPVFNGLEYEGTSVGQMLKLIHVLHGPGDSYDVEYREMVENGHVKTRVGLASYEWILARAFTPGVEL 80 
66391862    1 MMFTEAKCIVNRPRPVFNGIEYEGTSVGQMLKLIHVLHGPGDSYDVEYREMVENGHVKTRVGLASYEWILARAFTPGVEL 80 
109290040  81 TRIKPTEATLDRWSCIysEKWHD 103
37651540   81 TKVKPSKVTMSRWCSM--DQWRH 101
66391862   81 TKVKPSEVTMSRWCSM--DQWRH 101
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap