Conserved Protein Domain Family
PHA02097

?
PHA02097: PHA02097 
hypothetical protein
Statistics
?
PSSM-Id: 177344
View PSSM: PHA02097
Aligned: 3 rows
Threshold Bit Score: 104.247
Threshold Setting Gi: 66391827
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
37651505   1 MWKELDRDSQVITSAMNTPGGVIIRIAHTFDVSNFKIQFIAGVKVVKDANYNGFELVHG 59 
66391827   1 MWKELDRDSQVVTSAMNTPGGVIIRIAHTFDVSNVKIQFIAGVKVVKDANYNGFELVHG 59 
109290008  5 KWIEINRDNHGVTFAMNTPNGVLIRVNYTFKAEKFDMTFIPDIKVVSNPNGNGYIFCHG 63 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap