Conserved Protein Domain Family
PHA02096

?
PHA02096: PHA02096 
hypothetical protein
Statistics
?
PSSM-Id: 107116
View PSSM: PHA02096
Aligned: 3 rows
Threshold Bit Score: 156.035
Threshold Setting Gi: 66391826
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
109290007   1 MKKYVIQWKDVEGFCHFVDGNLYGSSSGVVFHNSWEDAKANMQKAKEAIAEYLKGTKVVKKRLFGLPTIVAINKPSEYLA 80 
66391826    1 MKKYALQWKDPEGFCHFVSGNLHGAFGGVMFHDSWEEADVSLKNAKKSIEEYLKGTTVIKKRLFGPPTIVSVNKPSGHLA 80 
37651504    1 MKKYALQWKDPEGFCHFVSGNLHGAFGGVMFHDSWEEADVSLKNAKKSIEEYLKGTTVIKKRLFGPPTIVSVNKPSGHLA 80 
109290007  81 NTHKRLCDTMHIADINVMPKQMR 103
66391826   81 NMHKRMYDTMHIAEINIMPKQMR 103
37651504   81 NMHKRMYDTMHIAEINIMPKQMR 103
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap