Conserved Protein Domain Family
PHA02094

?
PHA02094: PHA02094 
hypothetical protein
Statistics
?
PSSM-Id: 177343
View PSSM: PHA02094
Aligned: 3 rows
Threshold Bit Score: 161.71
Threshold Setting Gi: 66391822
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
109290003  1 MIYEHYGADSFWGTTIQTAMEIRNRLNSTMFLRFVKRKdYNARYEALIKSIGEMLGQKHPTAKTWVAKPNPFRDGVLVEI 80 
37651500   1 MIYEHFDKNSFWGSILIDGMKLNNKLSNIIMLPSTRKK-LTEKYEFFAKSVGAMIGELHPTAKTWVAKPNPFRDGVLVEI 79 
66391822   1 MIYEHFDKNSFWGSILIDGMKLNNKLSNSIMLPSTRKK-LMEKYEFFAKSVGAMIGELHPTAKTWVAKPNPFRDGVLVEI 79 
109290003 81 RE 82 
37651500  80 RE 81 
66391822  80 RE 81 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap