Conserved Protein Domain Family
PHA02092

?
PHA02092: PHA02092 
hypothetical protein
Statistics
?
PSSM-Id: 177342
View PSSM: PHA02092
Aligned: 3 rows
Threshold Bit Score: 209.13
Threshold Setting Gi: 37651495
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66391818    1 MCRPNYRLLLAEEKSHGVEKELYELYTSMNAIGANNQDTFGKLFKTEAYKLAQTEIAEYNEKIRKVILKNFPTVTRYQSE 80 
37651495    1 MCRPNYRLLLAEEKSHGVEKELYELYTSMNAVGANNQDTFGKLFKTKAYKLAQTEIAEYNEKIRKVILKNFPTATRYQSE 80 
109289998   1 MGAPNHRLLLCEEKSHGVEKELYDLFIEMNSIGANNQDTWGKLFKTKAYNESQTQMAEYKEKIRKIIATNFPQSITYAYE 80 
66391818   81 LIGLRGIVDVSMKRGQRILIKLSYGELK 108
37651495   81 LIGLRGIVDVSMKRGQRILIKLSYGELK 108
109289998  81 LIGLRGIVDVSMKRGQRILVKLQYEQ-- 106
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap