Conserved Protein Domain Family
PHA02091

?
PHA02091: PHA02091 
hypothetical protein
Statistics
?
PSSM-Id: 177341
View PSSM: PHA02091
Aligned: 3 rows
Threshold Bit Score: 129.257
Threshold Setting Gi: 66391817
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
37651494   1 MKIRLIDEKGFIDHCRKNIVDYKLARSIVDFTKTRELQIVQRDRGMWTLNVYGPLGKAQICRDQQKFFEVNQ 72 
109290225  1 MRIRLVDKKGFIDANRQDSQSYRLARTIVEFAKWRQLCVIGNDGPEWLLNVYGPCWRGRISANCKQYFEVQN 72 
66391817   1 MKIRLIDEKGFIDHCRKNIVDYKLARSIVDFAKTRELQIMQRDRGMWTLNVYGPLGKAQICRDQQKFFEVNQ 72 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap