Conserved Protein Domain Family
PHA02088

?
PHA02088: PHA02088 
hypothetical protein
Statistics
?
PSSM-Id: 107110
View PSSM: PHA02088
Aligned: 3 rows
Threshold Bit Score: 116.369
Threshold Setting Gi: 66391814
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66391814    1 MFQIIFIAGLVLGLIACCFSTWDSRWRKKARNEQAKINTWLAKYGISMNFKNGVVGAFEKVVFFMPGGDNAIFSECKGIN 80 
37651491    1 MFQIIFIAGLVLGLIACCFSTWDSRWRKKARNEQAKINTWLAKYGISMNFKNGVVGAFEKVVFFMPGGDNAIFSECKGIN 80 
109289995   1 MYQVIFIVVVSAVLIACYVSMWDDHWKRKCETEITAMNAWLKKYSMTMRLKGNKIGPFAKWV-IISDGTNVDFENCKGIG 79 
66391814   81 FRKAYKMLEQIRKDDIANPDFDQTGNLMSILYLSQAK--IEKTIWDK 125
37651491   81 FRKAYKMLEQIRKDDIANPDFDQTGNLMSILYLSQAK--IEKTIWDK 125
109289995  80 FRKLYKTLVKVRKDSIAYPILDQTGSLASLLYKSQMKkdVKKSIWED 126
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap