Conserved Protein Domain Family
PHA02087

?
PHA02087: PHA02087 
hypothetical protein
Statistics
?
PSSM-Id: 107109
View PSSM: PHA02087
Aligned: 3 rows
Threshold Bit Score: 129.302
Threshold Setting Gi: 37651487
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66391810   1 MKIVRVKFKSPEHRKAFAETEWYNLEFEKFMPDEFWARFDPNKVVQYCLVDSDGVKIELPESEGGGGITFDDEEMFHFFD 80 
37651487   1 MTIKRIRFKSEEHRKKFAESEWYNESFSKHMPDEFWAKYDSNKLVGYMLVDANGKKIELPEEEGGGGITFDDEEMFHFFD 80 
109289992  1 MKIVRVKFKSPEHRKAFAKSASYNAEFEKFMPDEFWLGFDPNKNVQYRLVDSDGVVIELPESTGGGGIIFDDEELYYFME 80 
66391810  81 EVK 83 
37651487  81 EVK 83 
109289992 81 IIE 83 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap