Conserved Protein Domain Family
PHA02085

?
PHA02085: PHA02085 
hypothetical protein
Statistics
?
PSSM-Id: 164890
View PSSM: PHA02085
Aligned: 3 rows
Threshold Bit Score: 144.377
Threshold Setting Gi: 66391806
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66391806   1 MKIRFKSEEHKAMFARRHDCNQWIADKMGTDWWEC-EYDANVYDDEASILILDEDVPLTGKYHAADDEdDDDDTAWVLFG 79 
37651483   1 MKIRFKSEDHKAMFARRHDCNQWIADKMGTDWWEC-EYDAHVYDDEASILILDEDVPLTGKYHAADDE-DDDDTAWVLFG 78 
109289988  1 MQITFKSEEHRKAFARIAKCNEWIAHTLGMDTWECrEEPADEYDKTPVLAVLDGFGNQVAGVFVYDGG-QCEDHAWVFWG 79 
66391806  80 ERQYFEIVE 88 
37651483  79 ERQYFEIVE 87 
109289988 80 EREYFDITE 88 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap