Conserved Protein Domain Family
PHA02078

?
PHA02078: PHA02078 
hypothetical protein
Statistics
?
PSSM-Id: 177339
View PSSM: PHA02078
Aligned: 3 rows
Threshold Bit Score: 69.1634
Threshold Setting Gi: 61805887
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
34419561  2 LGRYSLEEYYKENFAMITHGNFSLHDLETMVLFEREIYAAQLIHYIQEKNKEQQ 55 
61805887  1 MAHEDLESYYKINFALMQHHKYSLTELENMMPWEREIYLALLQQYIEEENLKQQ 54 
58533018  1 MFYNNLENYYRTNFSLMQHHKYSLAEIENMMPWERAVYVSLLNQYLKELEEKQK 54 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap