Conserved Protein Domain Family
PHA02067

?
PHA02067: PHA02067 
hypothetical protein
Statistics
?
PSSM-Id: 164889
View PSSM: PHA02067
Aligned: 3 rows
Threshold Bit Score: 391.342
Threshold Setting Gi: 109290011
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66391830    1 MKFLSvIALGLLSSSAMAASFDCNTTGLNSIEKAICKVPELSMMDQQLADAYKVVRHIPEVKADQKTFIKDRNSAPSLGD 80 
109290011   1 MKALT-IALLFAASTASAASLDCQVKNLNAIEKAICAVPEISLLDDQMAEAFKAVSHIPGVKVDQRAYIKTRNASTSLSE 79 
37651508    1 MKFLSvIALGLLSSSAMAASFDCNTTGLNSIEKAICKVPELSMMDQQLADAYKVVRHIPEVKADQKTFIKDRNSAPSLGD 80 
66391830   81 LKDLMRDRIIELEIIAELEGVEAKPYSE------RQVKPAKPIGSSSVGQLITQFKNGNTAVYNGQYLDATYRRSDAPSW 154
109290011  80 LKDNMTDRIIELQIIAELEGVQKKPHSEivrtdsAKATSNRPVEKDTVADLIWQAKQGDELNFRGKTSYTDYRDKNAPIW 159
37651508   81 LKDLMRDRIIELEIIAELEGVEAKPYSE------RQVKPAKPIGSSSVGQLITQFKNGNTAVYNGQYLDATYRRSDAPSW 154
66391830  155 ALGCSAKIVDNDVLPKWAAEASKNKLSSEFADVRWKFDVAMFNATLTNLLKNTDQSKT-MCDIINVGM 221
109290011 160 MRNCAYRIVRNEVMGRWVAQARSAGLINEFKSVEYKIETGFINMTIDNLKMNIQQSRQgMRNYGNRER 227
37651508  155 ALGCSAKIVDNDVLPKWAAEASKNKLSSEFADVRWKFDVAMFNATLANLLKNTDQSKT-MCDIINVGM 221
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap